PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_65242_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 106aa    MW: 12205.3 Da    PI: 10.723
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_65242_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.83.2e-151155347
                                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                      Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                                         +WT+eE++l++ + k++G+g+W+ I+r    +Rt+ q+ s+ qky
  cra_locus_65242_iso_1_len_316_ver_3 11 PWTEEEHKLFLMGLKKYGKGDWRNISRNYVITRTPTQVASHAQKY 55
                                         8*****************************89************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.7E-13360IPR009057Homeodomain-like
PROSITE profilePS5129420.742460IPR017930Myb domain
SuperFamilySSF466899.72E-18559IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-18759IPR006447Myb domain, plants
SMARTSM007176.7E-13858IPR001005SANT/Myb domain
PfamPF002491.0E-131155IPR001005SANT/Myb domain
CDDcd001672.38E-111156No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 106 aa     Download sequence    Send to blast
XNEQERKKGV PWTEEEHKLF LMGLKKYGKG DWRNISRNYV ITRTPTQVAS HAQKYFIRQL  60
SGGKDKRRAS IHDITTVHLN ENLTTPSPEN KKAPSPVHHP PAKQSX
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011080854.11e-56PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H74e-58DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A067LGQ16e-56A0A067LGQ1_JATCU; Uncharacterized protein
STRINGVIT_06s0004g06100.t012e-52(Vitis vinifera)
STRINGGLYMA11G22960.13e-52(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1644955